Host taxon 9606
Protein NP_002349.1
mitotic spindle assembly checkpoint protein MAD2A
Homo sapiens
Gene MAD2L1, UniProt Q13257
>NP_002349.1|Haemophilus ducreyi 35000HP|mitotic spindle assembly checkpoint protein MAD2A
MALQLSREQGITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDLELIKYLNNVVEQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEEVRLRSFTTTIHKVNSMVAYKIPVND
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.4 | 1.40217961134876 | 5.9e-15 | 31213562 | |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)