Host taxon 9606
Protein NP_001291203.1
mitochondrial inner membrane protease subunit 1
Homo sapiens
Gene IMMP1L, UniProt Q96LU5
>NP_001291203.1|Haemophilus ducreyi 35000HP|mitochondrial inner membrane protease subunit 1
MLRGVLGKTFRLVGYTIQYGCIAHCAFEYVGGVVMCSGPSMEPTIQNSDIVFAENLSRHFYGIQRGDIVIAKSPSDPKSNICKRVIGLEGDKILTTSPSDFFKSHSYVPMGHVWLEGDNLQNSTDSRCYGPIPYGLIRGRIFFKIWPLSDFGFLRASPNGHRFSDD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.73 | -0.730782197106831 | 0.003 | 31213562 | |
Retrieved 1 of 1 entries in 1.8 ms
(Link to these results)