Host taxon 9606
Protein NP_061932.1
mitochondrial import receptor subunit TOM7 homolog
Homo sapiens
Gene TOMM7, UniProt Q9P0U1
>NP_061932.1|Haemophilus ducreyi 35000HP|mitochondrial import receptor subunit TOM7 homolog
MVKLSKEAKQRLQQLFKGSQFAIRWGFIPLVIYLGFKRGADPGMPEPTVLSLLWG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.01 | 1.00961735285139 | 0.0083 | 31213562 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)