Host taxon 9606
Protein NP_001001790.1
mitochondrial import receptor subunit TOM5 homolog isoform 1
Homo sapiens
Gene TOMM5, UniProt Q8N4H5
>NP_001001790.1|Haemophilus ducreyi 35000HP|mitochondrial import receptor subunit TOM5 homolog isoform 1
MFRIEGLAPKLDPEEMKRKMREDVISSIRNFLIYVALLRVTPFILKKLDSI
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.29 | 1.29324931935817 | 1.7e-5 | 31213562 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)