Host taxon 9606
Protein NP_001291414.1
mitochondrial import inner membrane translocase subunit Tim9 isoform a
Homo sapiens
Gene TIMM9, UniProt Q9Y5J7
>NP_001291414.1|Haemophilus ducreyi 35000HP|mitochondrial import inner membrane translocase subunit Tim9 isoform a
MAAQIPESDQIKQFKEFLGTYNKLTETCFLDCVKDFTTREVKPEETTCSEHCLQKYLKMTQRISMRFQEYHIQQNEALAAKAGLLGQPR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.38 | 0.375691741020592 | 0.017 | 31213562 | |
Retrieved 1 of 5 entries in 0.9 ms
(Link to these results)