Host taxon 9606
Protein NP_001161419.1
mitochondrial import inner membrane translocase subunit Tim17-B isoform 1
Homo sapiens
Gene TIMM17B, UniProt O60830
>NP_001161419.1|Haemophilus ducreyi 35000HP|mitochondrial import inner membrane translocase subunit Tim17-B isoform 1
MEEYAREPCPWRIVDDCGGAFTMGVIGGGVFQAIKGFRNAPVCRLLSEAPLFIYSCSRSVSPTVNVSSERAESRPTLFMAVSLHMAWCLAHIGIRHRLRGSANAVRIRAPQIGGSFAVWGGLFSTIDCGLVRLRGKEDPWNSITSGALTGAVLAARSGPLAMVGSAMMGGILLALIEGVGILLTRYTAQQFRNAPPFLEDPSQLPPKDGTPAPGYPSYQQYH
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.07 | 1.0652968816183 | 0.00012 | 31213562 | |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)