Host taxon 9606
Protein NP_073729.1
microtubule-associated proteins 1A/1B light chain 3B
Homo sapiens
Gene MAP1LC3B, UniProt Q9GZQ8
>NP_073729.1|Haemophilus ducreyi 35000HP|microtubule-associated proteins 1A/1B light chain 3B
MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.54 | 0.544081159926563 | 0.025 | 31213562 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)