Host taxon 9606
Protein NP_001027535.1
MICOS complex subunit MIC10 isoform a
Homo sapiens
Gene MICOS10, UniProt Q5TGZ0
>NP_001027535.1|Haemophilus ducreyi 35000HP|MICOS complex subunit MIC10 isoform a
MSESELGRKWDRCLADAVVKIGTGFGLGIVFSLTFFKRRMWPLAFGSGMGLGMAYSNCQHDFQAPYLLHGKYVKEQEQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.53 | 0.530452882324869 | 0.0086 | 31213562 | |
Retrieved 1 of 2 entries in 2 ms
(Link to these results)