Host taxon 9606
Protein NP_001017369.1
methylsterol monooxygenase 1 isoform 2
Homo sapiens
Gene MSMO1, UniProt Q15800
>NP_001017369.1|Haemophilus ducreyi 35000HP|methylsterol monooxygenase 1 isoform 2
MPRWYFLLARCFGCAVIEDTWHYFLHRLLHHKRIYKYIHKVHHEFQAPFGMEAEYAHPLETLILGTGFFIGIVLLCDHVILLWAWVTIRLLETIDVHSGYDIPLNPLNLIPFYAGSRHHDFHHMNFIGNYASTFTWWDRIFGTDSQYNAYNEKRKKFEKKTE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ -1.95 | -1.95233407087113 | 0.0016 | 31213562 | |
Retrieved 1 of 1 entries in 2.1 ms
(Link to these results)