Host taxon 9606
Protein NP_001026849.1
methionine-R-sulfoxide reductase B3 isoform 2 precursor
Homo sapiens
Gene MSRB3, UniProt Q8IXL7
>NP_001026849.1|Haemophilus ducreyi 35000HP|methionine-R-sulfoxide reductase B3 isoform 2 precursor
MSAFNLLHLVTKSQPVALRACGLPSGSCRDKKNCKVVFSQQELRKRLTPLQYHVTQEKGTESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEAITFTDDFSYGMHRVETSCSQCGAHLGHIFDDGPRPTGKRYCINSAALSFTPADSSGTAEGGSGVASPAQADKAEL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.67 | -0.670331113630989 | 0.02 | 31213562 | |
Retrieved 1 of 1 entries in 1.7 ms
(Link to these results)