Host taxon 9606
Protein NP_036360.3
methionine-R-sulfoxide reductase B2, mitochondrial precursor
Homo sapiens
Gene MSRB2, UniProt Q9Y3D2
>NP_036360.3|Haemophilus ducreyi 35000HP|methionine-R-sulfoxide reductase B2, mitochondrial precursor
MARLLWLLRGLTLGTAPRRAVRGQAGGGGPGTGPGLGEAGSLATCELPLAKSEWQKKLTPEQFYVTREKGTEPPFSGIYLNNKEAGMYHCVCCDSPLFSSEKKYCSGTGWPSFSEAHGTSGSDESHTGILRRLDTSLGSARTEVVCKQCEAHLGHVFPDGPGPNGQRFCINSVALKFKPRKH
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.04 | 1.04203888544183 | 0.008 | 31213562 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)