Host taxon 9606
Protein NP_005944.1
metallothionein-2
Homo sapiens
Gene MT2A, UniProt P02795
>NP_005944.1|Haemophilus ducreyi 35000HP|metallothionein-2
MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSCCA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● 5.06 | 5.06369397843258 | 2.9e-27 | 31213562 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)