Host taxon 9606
Protein NP_001288196.1
metallothionein-1G isoform 2
Homo sapiens
Gene MT1G, UniProt P13640
>NP_001288196.1|Haemophilus ducreyi 35000HP|metallothionein-1G isoform 2
MDPNCSCAAAGVSCTCASSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASEKCSCCA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● 4.99 | 4.99236206926832 | 4.3e-14 | 31213562 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)