Host taxon 9606
Protein NP_001288201.1
metallothionein-1F isoform 2
Homo sapiens
Gene MT1F, UniProt P04733
>NP_001288201.1|Haemophilus ducreyi 35000HP|metallothionein-1F isoform 2
MDPNCSCAAGVSCTCAGSCKCKECKCTSCKKSECEAISMVWGCG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●○ 3.97 | 3.97125427411295 | 1.4e-13 | 31213562 | |
Retrieved 1 of 2 entries in 0.9 ms
(Link to these results)