Host taxon 9606
Protein NP_001272323.1
melanocortin-2 receptor accessory protein isoform c
Homo sapiens
Gene MRAP, UniProt Q8TCY5
>NP_001272323.1|Haemophilus ducreyi 35000HP|melanocortin-2 receptor accessory protein isoform c
MSWSASPQMRNSPKHHQTCPWSHGLNLHLCIQKCLPCHREPLATSQAQASSVEPGSRTGPDQPLRQESSSTLPLGGFQTHPTLLWELTLNGGPLVRSKPSEPPPGDRTSQLQS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.94 | -0.940422632401721 | 0.00067 | 31213562 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)