Host taxon 9606
Protein NP_001001683.1
mediator of RNA polymerase II transcription subunit 11 isoform a
Homo sapiens
Gene MED11, UniProt Q9P086
>NP_001001683.1|Haemophilus ducreyi 35000HP|mediator of RNA polymerase II transcription subunit 11 isoform a
MATYSLANERLRALEDIEREIGAILQNAGTVILELSKEKTNERLLDRQAAAFTASVQHVEAELSAQIRYLTQVATGQPHEGSSYSSRKDCQMALKRVDYARLKLSDVARTCEQMLEN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.26 | 1.25683676463069 | 0.00014 | 31213562 | |
Retrieved 1 of 2 entries in 0.7 ms
(Link to these results)