Host taxon 9606
Protein NP_115662.2
mediator of RNA polymerase II transcription subunit 10
Homo sapiens
Gene MED10, UniProt Q9BTT4
>NP_115662.2|Haemophilus ducreyi 35000HP|mediator of RNA polymerase II transcription subunit 10
MAEKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHDITVPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELSKVFPEDMAKYRSIRGEDHPPS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.9 | 0.898909950979793 | 6.1e-6 | 31213562 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)