Host taxon 9606
Protein NP_690006.2
maturin
Homo sapiens
Gene MTURN, UniProt Q8N3F0
>NP_690006.2|Haemophilus ducreyi 35000HP|maturin
MDFQQLADVAEKWCSNTPFELIATEETERRMDFYADPGVSFYVLCPDNGCGDNFHVWSESEDCLPFLQLAQDYISSCGKKTLHEVLEKVFKSFRPLLGLPDADDDAFEEYSADVEEEEPEADHPQMGVSQQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ -1.44 | -1.44314461997992 | 4.4e-6 | 31213562 | |
Retrieved 1 of 1 entries in 0.5 ms
(Link to these results)