Host taxon 9606
Protein NP_001027449.1
matrix metalloproteinase-28 isoform 3 precursor
Homo sapiens
Gene MMP28, UniProt Q9H239
>NP_001027449.1|Haemophilus ducreyi 35000HP|matrix metalloproteinase-28 isoform 3 precursor
MVARVGLLLRALQLLLWGHLDAQPAERGGQELRKEAEAFLEKYGYLNEQVPKAPTSTRFSDAIRAFQWVSQLPVSGVLDRATLRQMTRPRCGVTDTNSYAAWAERISDLFARHRTKMRRKKRFAKQGEHC
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.79 | 1.78718293652898 | 0.007 | 31213562 | |
Retrieved 1 of 3 entries in 0.8 ms
(Link to these results)