Host taxon 9606
Protein NP_001317002.1
mannose-P-dolichol utilization defect 1 protein isoform 2
Homo sapiens
Gene MPDU1, UniProt O75352
>NP_001317002.1|Haemophilus ducreyi 35000HP|mannose-P-dolichol utilization defect 1 protein isoform 2
MAAEADGPLKRLLVPILLPEKCYDQLFVQWDLLHVPCLKILLSKGLGLGIVAGSLLVKLPQVFKILGAKSAEGLSLQSVMLELVALTGTMVYSITNNFPFSSWGEALFLMLQTITICFLVMHYRGQTVKGAGDLPKSRLCGSWEPCWELSFSRQPPTTTTGTQASSQPSQSSCCLGAPWPESSLPFRKPEIP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.9 | 0.895275370559754 | 2.9e-5 | 31213562 | |
Retrieved 1 of 4 entries in 1 ms
(Link to these results)