Host taxon 9606
Protein NP_002398.1
mammaglobin-B precursor
Homo sapiens
Gene SCGB2A1, UniProt O75556
>NP_002398.1|Haemophilus ducreyi 35000HP|mammaglobin-B precursor
MKLLMVLMLAALLLHCYADSGCKLLEDMVEKTINSDISIPEYKELLQEFIDSDAAAEAMGKFKQCFLNQSHRTLKNFGLMMHTVYDSIWCNMKSN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●○ -3.19 | -3.18798839220215 | 0.015 | 31213562 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)