Host taxon 9606
Protein NP_001258490.1
alternative prion protein isoform AltPrp
Homo sapiens
Gene PRNP, UniProt F7VJQ1
>NP_001258490.1|Haemophilus ducreyi 35000HP|alternative prion protein isoform AltPrp
MEHWGQPIPGAGQPWRQPLPTSGRWWLGAASWWWLGAASWWWLGAAPWWWLGTASWWWLGSRRWHPQSVEQAE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.86 | 0.859640140649624 | 1.2e-6 | 31213562 | |
Retrieved 1 of 3 entries in 0.9 ms
(Link to these results)