Host taxon 9606
Protein NP_001271346.1
lysM and putative peptidoglycan-binding domain-containing protein 4 isoform b
Homo sapiens
Gene LYSMD4, UniProt Q5XG99
>NP_001271346.1|Haemophilus ducreyi 35000HP|lysM and putative peptidoglycan-binding domain-containing protein 4 isoform b
MRHEELLTKTFQGPAVVCGTPTSHVYMFKNGSGDSGDSSEEESHRVVLRPRGKERHKSGVHQPPQAGAGDVVLLQRELAQEDSLNKLALQYGCKVADIKKVNNFIREQDLYALKSVKIPVRNHGILMETHKELKPLLSPSSETTVTVELPEADRAGAGTGAQAGQLMGFFKGIDQDIERAVQSEIFLHESYCMDTSHQPLLPAPPKTPMDGADCGIQWWNAVFIMLLIGIVLPVFYLVYFKIQASGETPNSLNTTVIPNGSMAMGTVPGQAPRLAVAVPAVTSADSQFSQTTQAGS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ -1.08 | -1.08228286538923 | 4.1e-5 | 31213562 | |
Retrieved 1 of 3 entries in 1.9 ms
(Link to these results)