Host taxon 9606
Protein NP_001070148.1
LYR motif-containing protein 9
Homo sapiens
Gene LYRM9, UniProt A8MSI8
>NP_001070148.1|Haemophilus ducreyi 35000HP|LYR motif-containing protein 9
MAPLPGAELVRRPLQLYRYLLRCCQQLPTKGIQQHYKHAVRQSFRVHSDEDNPERIQQIIKRAIEDADWIMNKYKKQN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.46 | -0.46039269982525 | 0.0055 | 31213562 | |
Retrieved 1 of 1 entries in 1.4 ms
(Link to these results)