Host taxon 9606
Protein NP_076435.1
LYNX1-SLURP2 protein precursor
Homo sapiens
Gene LYNX1, UniProt P0DP58
>NP_076435.1|Haemophilus ducreyi 35000HP|LYNX1-SLURP2 protein precursor
MTPLLTLILVVLMGLPLAQALDCHVCAYNGDNCFNPMRCPAMVAYCMTTRTSAAEAIWCHQCTGFGGCSHGSRCLRDSTHCVTTATRVLSNTEDLPLVTKMCHIGCPDIPSLGLGPYVSIACCQTSLCNHD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.92 | -0.921533453357679 | 0.029 | 31213562 | |
Retrieved 1 of 1 entries in 1.7 ms
(Link to these results)