Host taxon 9606
Protein NP_001303931.1
ly6/PLAUR domain-containing protein 6B isoform a
Homo sapiens
Gene LYPD6B, UniProt Q8NI32
>NP_001303931.1|Haemophilus ducreyi 35000HP|ly6/PLAUR domain-containing protein 6B isoform a
MLLITLSANLFTVPERSLTTTFSFSRYKSSDRPAHKVSMLLLCHALAIAVVQIVIFSESWAFAKNINFYNVRPPLDPTPFPNSFKCFTCENAGDNYNCNRWAEDKWCPQNTQYCLTVHHFTSHGRSTSITKKCASRSECHFVGCHHSRDSEHTECRSCCEGMICNVELPTNHTNAVFAVMHAQRTSGSSAPTLYLPVLAWVFVLPLL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●○○ -2.33 | -2.32859646903342 | 1.6e-5 | 31213562 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)