Host taxon 9606
Protein NP_001026919.2
ly6/PLAUR domain-containing protein 5 isoform A precursor
Homo sapiens
Gene LYPD5, UniProt Q6UWN5
>NP_001026919.2|Haemophilus ducreyi 35000HP|ly6/PLAUR domain-containing protein 5 isoform A precursor
MAMGVPRVILLCLFGAALCLTGSQALQCYSFEHTYFGPFDLRAMKLPSISCPHECFEAILSLDTGYRAPVTLVRKGCWTGPPAGQTQSNADALPPDYSVVRGCTTDKCNAHLMTHDALPNLSQAPDPPTLSGAECYACIGVHQDDCAIGRSRRVQCHQDQTACFQGNGRMTVGNFSVPVYIRTCHRPSCTTEGTTSPWTAIDLQGSCCEGYLCNRKSMTQPFTSASATTPPRALQVLALLLPVLLLVGLSA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.12 | 1.12389403110789 | 0.038 | 31213562 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)