Host taxon 9606
Protein NP_001278348.1
ly6/PLAUR domain-containing protein 4 precursor
Homo sapiens
Gene LYPD4, UniProt Q6UWN0
>NP_001278348.1|Haemophilus ducreyi 35000HP|ly6/PLAUR domain-containing protein 4 precursor
MGPQHLRLVQLFCLLGAISTLPRMSCGAGCYKTQKGTARGVVGFKGCSSSSSYPAQISYLVSPPGVSIASYSRVCRSYLCNNLTNLEPFVKLKASTPKSITSASCSCPTCVGEHMKDCLPNFVTTNSCPLAASTCYSSTLKFQAGFLNTTFLLMGCAREHNQLLADFHHIGSIKVTEVLNILEKSQIVGAASSRQDPAWGVVLGLLFAFRD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● 5.41 | 5.41220109748446 | 2.7e-5 | 31213562 | |
Retrieved 1 of 2 entries in 1.1 ms
(Link to these results)