Host taxon 9606
Protein NP_991108.1
ly6/PLAUR domain-containing protein 2 precursor
Homo sapiens
Gene LYPD2, UniProt Q6UXB3
>NP_991108.1|Haemophilus ducreyi 35000HP|ly6/PLAUR domain-containing protein 2 precursor
MRGTRLALLALVLAACGELAPALRCYVCPEPTGVSDCVTIATCTTNETMCKTTLYSREIVYPFQGDSTVTKSCASKCKPSDVDGIGQTLPVSCCNTELCNVDGAPALNSLHCGALTLLPLLSLRL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●○○ 2.28 | 2.28208125883864 | 5.1e-5 | 31213562 | |
Retrieved 1 of 2 entries in 1.4 ms
(Link to these results)