Host taxon 9606
Protein NP_001129691.1
low affinity immunoglobulin gamma Fc region receptor II-a isoform 1 precursor
Homo sapiens
Gene FCGR2A, UniProt P12318
>NP_001129691.1|Haemophilus ducreyi 35000HP|low affinity immunoglobulin gamma Fc region receptor II-a isoform 1 precursor
MTMETQMSQNVCPRNLWLLQPLTVLLLLASADSQAAAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMGIIVAVVIATAVAAIVAAVVALIYCRKKRISANSTDPVKAAQFEPPGRQMIAIRKRQLEETNNDYETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVNSNN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● 5.03 | 5.02862460375648 | 1.8e-20 | 31213562 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)