Host taxon 9606
Protein NP_005770.1
LHFPL tetraspan subfamily member 2 protein
Homo sapiens
Gene LHFPL2, UniProt Q6ZUX7
>NP_005770.1|Haemophilus ducreyi 35000HP|LHFPL tetraspan subfamily member 2 protein
MCHVIVTCRSMLWTLLSIVVAFAELIAFMSADWLIGKARSRGGVEPAGPGGGSPEPYHPTLGIYARCIRNPGVQHFQRDTLCGPYAESFGEIASGFWQATAIFLAVGIFILCMVALVSVFTMCVQSIMKKSIFNVCGLLQGIAGLFLILGLILYPAGWGCQKAIDYCGHYASAYKPGDCSLGWAFYTAIGGTVLTFICAVFSAQAEIATSSDKVQEEIEEGKNLICLL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.29 | 1.29324863928113 | 7.3e-7 | 31213562 | |
Retrieved 1 of 2 entries in 1.5 ms
(Link to these results)