Host taxon 9606
Protein NP_054766.1
leydig cell tumor 10 kDa protein homolog
Homo sapiens
Gene C19orf53, UniProt Q9UNZ5
>NP_054766.1|Haemophilus ducreyi 35000HP|leydig cell tumor 10 kDa protein homolog
MAQGQRKFQAHKPAKSKTAAAASEKNRGPRKGGRVIAPKKARVVQQQKLKKNLEVGIRKKIEHDVVMKASSSLPKKLALLKAPAKKKGAAAATSSKTPS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.44 | 1.44410603238645 | 0.00041 | 31213562 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)