Host taxon 9606
Protein NP_001265140.1
leucine-rich repeat-containing protein 20 isoform 1
Homo sapiens
Gene LRRC20, UniProt Q8TCA0
>NP_001265140.1|Haemophilus ducreyi 35000HP|leucine-rich repeat-containing protein 20 isoform 1
MLKKMGEAVARVARKVNETVESGSDTLDLAECKLVSFPIGIYKVLRNVSGQIHLITLANNELKSLTSKFMTTFSQLRELHLEGNFLHRLPSEVSALQHLKAIDLSRNQFQDFPEQLTALPALETINLEENEIVDVPVEKLAAMPALRSINLRFNPLNAEVRVIAPPLIKFDMLMSPEGARAPLP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.58 | 0.576253063025892 | 0.0032 | 31213562 | |
Retrieved 1 of 5 entries in 0.7 ms
(Link to these results)