Host taxon 9606
Protein NP_001092254.1
leucine repeat adapter protein 25 isoform 3
Homo sapiens
Gene FAM89B, UniProt Q8N5H3
>NP_001092254.1|Haemophilus ducreyi 35000HP|leucine repeat adapter protein 25 isoform 3
MNGLPSAEAPGGAGCALAGLPPLPRGLSGLLNASGGSWRELERVYSQRSRIHDELSRAARAPDGPRHAAGAANAGPAAGPRRPVNLDSALAALRKEMLSAGGAAAVGHVLVVPAVGPVRVNPGLQTPVPRPELLPGPVILPPFGQLLPTGCGPV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.72 | 0.720289387735888 | 0.0025 | 31213562 | |
Retrieved 1 of 1 entries in 2.1 ms
(Link to these results)