Host taxon 9606
Protein NP_001292583.1
lck-interacting transmembrane adapter 1 isoform 2 precursor
Homo sapiens
Gene LIME1, UniProt Q9H400
>NP_001292583.1|Haemophilus ducreyi 35000HP|lck-interacting transmembrane adapter 1 isoform 2 precursor
MGLPVSWAPPALWVLGCCALLLSLWALCTACRRPEDAVAPRKRARRQRARLQGSATAAEAQVGHQTARAAPGPAQQQGPAACQHGSPAPTLAGGVQGHHRTAGSPLCLPTPGAAPGSAGSCSHRRVRWPRGHLFQRGAGGPSRGQPGGQPCGGRVCPRPEAQRDPSQSPRATAGED
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.09 | 1.08526745796521 | 0.0021 | 31213562 | |
Retrieved 1 of 2 entries in 1.1 ms
(Link to these results)