Host taxon 9606
Protein NP_055172.1
late cornified envelope protein 2B
Homo sapiens
Gene LCE2B, UniProt O14633
>NP_055172.1|Haemophilus ducreyi 35000HP|late cornified envelope protein 2B
MSCQQNQQQCQPPPKCPPKCTPKCPPKCPPKCLPQCPAPCSPAVSSCCGPISGGCCGPSSGGCCNSGAGGCCLSHHRPRLFHRRRHQSPDCCESEPSGGSGCCHSSGGCC
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.93 | -0.93309760811123 | 0.025 | 31213562 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)