Host taxon 9606
Protein NP_848129.1
late cornified envelope protein 1D
Homo sapiens
Gene LCE1D, UniProt Q5T752
>NP_848129.1|Haemophilus ducreyi 35000HP|late cornified envelope protein 1D
MSCQQSQQQCQPPPKCTPKCTPKCPAPKCPPKCPPVSSCCSVSSGGCCGSSSGGGCGSNSGGCCSSGGGGCCLSHHRRHRSHRRRPQSSDCCSQPSGGSSCCGGGSSQHSGGCC
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ -1.25 | -1.24931899688387 | 0.032 | 31213562 | |
Retrieved 1 of 1 entries in 1.7 ms
(Link to these results)