Host taxon 9606
Protein NP_848128.1
late cornified envelope protein 1C isoform 1
Homo sapiens
Gene LCE1C, UniProt Q5T751
>NP_848128.1|Haemophilus ducreyi 35000HP|late cornified envelope protein 1C isoform 1
MSCQQSQQQCQPPPKCTPKCPPKCPTPKCPPKCPPKCPPVSSCCSVSSGGCCGSSSGGSCGSSSGGCCSSGGGGCCLSHHRRRRSHCHRPQSSGCCSQPSGGSSCCGGGSGQHSGGCC
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ -1.2 | -1.2041695994388 | 0.0056 | 31213562 | |
Retrieved 1 of 1 entries in 1.7 ms
(Link to these results)