Host taxon 9606
Protein NP_848125.1
late cornified envelope protein 1A
Homo sapiens
Gene LCE1A, UniProt Q5T7P2
>NP_848125.1|Haemophilus ducreyi 35000HP|late cornified envelope protein 1A
MSCQQSQQQCQPPPKCTPKCPPKCPTPKCPPKCPPKCPPVSSCCSVSSGGCCGSSSGGGCSSGGGGCCLSHHRRHRSHRHRLQSSGCCSQPSGGSSCCGGDSGQHSGGCC
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.98 | -0.979558543905706 | 0.012 | 31213562 | |
Retrieved 1 of 1 entries in 1.5 ms
(Link to these results)