Host taxon 9606
Protein NP_001030175.1
Kv channel-interacting protein 4 isoform 5
Homo sapiens
Gene KCNIP4, UniProt Q6PIL6
>NP_001030175.1|Haemophilus ducreyi 35000HP|Kv channel-interacting protein 4 isoform 5
MSGCRKRCKREILKFAQYLLRLLTGSLHTDSVEDELEMATVRHRPEALELLEAQSKFTKKELQILYRGFKNECPSGVVNEETFKEIYSQFFPQGDSTTYAHFLFNAFDTDHNGAVSFEDFIKGLSILLRGTVQEKLNWAFNLYDINKDGYITKEEMLDIMKAIYDMMGKCTYPVLKEDAPRQHVETFFQKMDKNKDGVVTIDEFIESCQKDENIMRSMQLFENVI
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.84 | -0.83856360816908 | 0.039 | 31213562 | |
Retrieved 1 of 2 entries in 0.4 ms
(Link to these results)