Host taxon 9606
Protein NP_848550.1
kunitz-type protease inhibitor 4 precursor
Homo sapiens
Gene SPINT4, UniProt Q6UDR6
>NP_848550.1|Haemophilus ducreyi 35000HP|kunitz-type protease inhibitor 4 precursor
MKSAKLGFLLRFFIFCSLNTLLLGGVNKIAEKICGDLKDPCKLDMNFGSCYEVHFRYFYNRTSKRCETFVFSGCNGNLNNFKLKIEREVACVAKYKPPR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●○○ -2.16 | -2.15812932169675 | 0.0015 | 31213562 | |
Retrieved 1 of 1 entries in 1.8 ms
(Link to these results)