Host taxon 9606
Protein NP_001316028.1
killer cell lectin-like receptor subfamily G member 1 isoform a
Homo sapiens
Gene KLRG1, UniProt Q96E93
>NP_001316028.1|Haemophilus ducreyi 35000HP|killer cell lectin-like receptor subfamily G member 1 isoform a
MTDSVIYSMLELPTATQAQNDYGPQQKSSSSRPSCSCLVAIALGLLTAVLLSVLLYQWILCQGSNYSTCASCPSCPDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEMSLLQVFLSEAFCWIGLRNNSGWRWEDGSPLNFSRISSNSFVQTCGAINKNGLQASSCEVPLHWVCKKCPFADQALF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.41 | 1.41408157205982 | 0.0005 | 31213562 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)