Host taxon 9606
Protein NP_001306232.1
kazal-type serine protease inhibitor domain-containing protein 1 isoform b
Homo sapiens
Gene KAZALD1, UniProt Q96I82
>NP_001306232.1|Haemophilus ducreyi 35000HP|kazal-type serine protease inhibitor domain-containing protein 1 isoform b
MPTSLWHTRGPANRTGCLCWAMLFSDLPPSPPGPQIVSHPYDTWNVTGQDVIFGCEVFAYPMASIEWRKDGLDIQLPGDDPHISVQFRGGPQRFEVTGWLQIQAVRPSDEGTYRCLGRNALGQVEAPASLTVLTPDQLNSTGIPQLRSLNLVPEEEAESEENDDYY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ -1.21 | -1.20861700808147 | 5.7e-6 | 31213562 | |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)