Host taxon 9606
Protein NP_001268360.1
kallikrein-8 isoform 5
Homo sapiens
Gene KLK8, UniProt O60259
>NP_001268360.1|Haemophilus ducreyi 35000HP|kallikrein-8 isoform 5
MLLQLRDQASLGSKVKPISLADHCTQPGQKCTVSGWGTVTSPRENFPDTLNCAEVKIFPQKKCEDAYPGQITDGMVCAGSSKGADTCQGDSGGPLVCDGALQGITSWGSDPCGRSDKPGVYTNICRYLDWIKKIIGSKG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.63 | 0.631562284510255 | 0.047 | 31213562 | |
Retrieved 1 of 2 entries in 0.5 ms
(Link to these results)