Host taxon 9606
Protein NP_001036170.1
IQ domain-containing protein J isoform CaMBPv1
Homo sapiens
Gene IQCJ, UniProt Q1A5X6
>NP_001036170.1|Haemophilus ducreyi 35000HP|IQ domain-containing protein J isoform CaMBPv1
MRLEELKRLQNPLEQVNDGKYSFENHQLAMDAENNIEKYPLNLQPLESKVKIIQRAWREYLQRQEPLGKRSPSPPSVSSEKLSSSVSMNTFSDSSTPFARAPVGKIHPYISWRLQSPGDKLPGGRKVILLYLDQLARPTGFIHTLKEPQIERLGFLTLQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●○ -3.13 | -3.12850173965736 | 0.0049 | 31213562 | |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)