Host taxon 9606
Protein NP_001165887.1
inward rectifier potassium channel 13 isoform 2
Homo sapiens
Gene KCNJ13, UniProt O60928
>NP_001165887.1|Haemophilus ducreyi 35000HP|inward rectifier potassium channel 13 isoform 2
MDSSNCKVIAPLLSQRYRRMVTKDGHSTLQMDGAQRGLAYLRDAWGILMDMRWRWMMLVFSASFVVHWLVFAVLWCFCGEDCPAKKSSFFNSLY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.45 | -0.450542929534031 | 0.027 | 31213562 | |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)