Host taxon 9606
Protein NP_001254703.1
intraflagellar transport protein 20 homolog isoform 1
Homo sapiens
Gene IFT20, UniProt Q8IY31
>NP_001254703.1|Haemophilus ducreyi 35000HP|intraflagellar transport protein 20 homolog isoform 1
MTHLLLTATVTPSEQNSSREPGWETAMAKDILGEAGLHFDELNKLRVLDPEVTQQTIELKEECKDFVDKIGQFQKIVGGLIELVDQLAKEAENEKMKAIGARNLLKSIAKQREAQQQQLQALIAEKKMQLERYRVEYEALCKVEAEQNEFIDQFIFQK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.8 | 0.798447794596367 | 0.0038 | 31213562 | |
Retrieved 1 of 3 entries in 0.4 ms
(Link to these results)