Host taxon 9606
Protein NP_001172085.1
interleukin-24 isoform 3 precursor
Homo sapiens
Gene IL24, UniProt Q13007
>NP_001172085.1|Haemophilus ducreyi 35000HP|interleukin-24 isoform 3 precursor
MNFQQRLQSLWTLASRPFCPPLLATASQMQMVVLPCLGFTLLLWSQVSGAQGQEFHFGPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQLDVEAALTKALGEVDILLTWMQKFYKL
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● 7.86 | 7.85914297808667 | 1.4e-20 | 31213562 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)