Host taxon 9606
Protein NP_065386.1
interleukin-22 precursor
Homo sapiens
Gene IL22, UniProt Q9GZX6
>NP_065386.1|Haemophilus ducreyi 35000HP|interleukin-22 precursor
MAALQKSVSSFLMGTLATSCLLLLALLVQGGAAAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●○ 3.17 | 3.17114674710348 | 0.011 | 31213562 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)