Host taxon 9606
Protein NP_001193935.1
interleukin-21 isoform 2 precursor
Homo sapiens
Gene IL21, UniProt Q9HBE4
>NP_001193935.1|Haemophilus ducreyi 35000HP|interleukin-21 isoform 2 precursor
MRSSPGNMERIVICLMVIFLGTLVHKSSSQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKVSTLSFI
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● 5.17 | 5.16901772996782 | 0.002 | 31213562 | |
Retrieved 1 of 1 entries in 1.4 ms
(Link to these results)